PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G047700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family LBD
Protein Properties Length: 307aa    MW: 33289.6 Da    PI: 6.5939
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G047700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260112.62.6e-3512107196
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rr+C++dC+la+yfp+++p+ f+n+h+lFG++n+lk+l+++ +e+r++am++++ye++a+  +P  G+v +i +lq++++q+ 
  Seita.4G047700.1.p  12 ACAACKYQRRRCTPDCPLAEYFPHDRPRVFRNAHRLFGVNNILKTLARAGPEKRREAMHCIIYESHAWDINPATGCVPIIDDLQRRICQAG 102
                         7****************************************************************************************98 PP

              DUF260  92 aelal 96 
                          +l +
  Seita.4G047700.1.p 103 LDLRR 107
                         77765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.65811112IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-3412106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MAAGGAGAGA AACAACKYQR RRCTPDCPLA EYFPHDRPRV FRNAHRLFGV NNILKTLARA  60
GPEKRREAMH CIIYESHAWD INPATGCVPI IDDLQRRICQ AGLDLRRVYA AIRAYRAAAA  120
AAQGRPVPDS DGGDPSASAS SPAPPPPFQF QPAMGNNYDE ATAEAYGGGG LPFLMYGGDQ  180
QQMMMNAAAP DNENIALQMP PWMMQPPQYD MASATAVADM AAGKVVPQLQ QQDHRFLVDA  240
TMAHQSRNQQ KPIVPIHLPA ELDDKMSYFV NGMDGDSEMH HESTSMDSSE KKARQAPKME  300
DANGFK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443664.12e-48hypothetical protein SORBIDRAFT_08g023100
TrEMBLK3Y1I70.0K3Y1I7_SETIT; Uncharacterized protein
STRINGSi008052m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP154591316
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.18e-24LOB domain-containing protein 22